Bacterial taxon 1392858
Locus CO715_11720
Protein ATI06314.1
4,5-DOPA dioxygenase extradiol
Escherichia coli M12
Length 262 aa, Gene n/a, UniProt n/a
>ATI06314.1|Escherichia coli M12|4,5-DOPA dioxygenase extradiol
MSSTRMPALFLGHGSPMNVLEDNLYTRSWQKLGMTLPRPQAIVVVSAHWFTRGTGVTAMETPPTIHDFGGFPQALYDTHYPAPGSPALAQHLVELLAPVPVTLDKEAWGFDHGSWGVLIKMYPQADIPMVQLSIDSSKPAAWHFEMGRKLAALRDEGIMLVASGNVVHNLRTVKWHGDSSPYPWAMSFNEYVKANLTWQGPVEQHPLVNYLDHEGGALSNPTPEHYLPLLYVLGAWDGQEPITIPVDGIEMGSLSMLSVQIG
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.08 | 2.2e-32 | ●○○○○ -0.93 | -0.9308880043497025 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.6 | 0.0086 | ○○○○○ 0.21 | 0.21270079974830594 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)