Bacterial taxon 1392858
Locus CO715_18045
Protein ATI07452.1
5-formyltetrahydrofolate cyclo-ligase
Escherichia coli M12
Length 200 aa, Gene n/a, UniProt n/a
>ATI07452.1|Escherichia coli M12|5-formyltetrahydrofolate cyclo-ligase
MTQLPELPLTLSRQEIRKMIRQRRRTLTPEQQQEMGQQAATRMMTYPPVVMAHTVAVFLSFDGELDTQPLIEQLWRAGKRVYLPVLHPFSAGNLLFLNYHPQSELVMNRLKIHEPKLDVRDVLPLSRLDVLITPLVAFDEYGQRLGMGGGFYDRTLQNWQHYKMQPVGYAHDCQLVEKLPVEEWDIPLPAVVTPSKVWEW
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.13 | 0.00013 | ●○○○○ -0.52 | -0.5238196305501743 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -0.58 | 0.0038 | ○○○○○ 0.43 | 0.4251024422536467 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)