Bacterial taxon 1392858   Locus CO715_15120   Protein ATI06929.1

50S ribosomal protein L36

Escherichia coli M12

Length 46 aa, Gene n/a, UniProt n/a

>ATI06929.1|Escherichia coli M12|50S ribosomal protein L36
MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQGRKKKR

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus BALB/c)mammary gland BTO:000081724 hnot available in this study-10.965.2e-10●●○○○ -1.74-1.740017247606786829101196
Mouse (Mus musculus BALB/c)spleen BTO:000128124 hnot available in this study-1.050.36○○○○○ 0.330.3276647535994285429101196
Retrieved 2 of 2 entries in 17.5 ms (Link to these results)