Bacterial taxon 1392858
Locus CO715_17210
Protein ATI07302.1
6-carboxytetrahydropterin synthase QueD
Escherichia coli M12
Length 121 aa, Gene n/a, UniProt n/a
>ATI07302.1|Escherichia coli M12|6-carboxytetrahydropterin synthase QueD
MMSTTLFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPTYERLDHYYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRGE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.65 | 3.5e-18 | ●●○○○ -1.05 | -1.0498162324715534 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.66 | 3.0e-24 | ○○○○○ 1.52 | 1.5177816188749331 | 29101196 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)