Bacterial taxon 1392858
Locus CO715_11050
Protein ATI06190.1
6-phosphofructokinase II
Escherichia coli M12
Length 309 aa, Gene n/a, UniProt n/a
>ATI06190.1|Escherichia coli M12|6-phosphofructokinase II
MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFPAGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSQDDTQKIYAYLSR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.51 | 6.3e-22 | ●○○○○ -0.19 | -0.18643902550976565 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.41 | 1.2e-10 | ○○○○○ 0.04 | 0.04244565212123514 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)