Bacterial taxon 1392858
Locus CO715_21345
Protein ATI08046.1
ABC transporter permease
Escherichia coli M12
Length 341 aa, Gene n/a, UniProt n/a
>ATI08046.1|Escherichia coli M12|ABC transporter permease
MSRLSPVNQARWARFRHNRRGYWSLWIFLVLFGLSLCSELIANDKPLLVRYDGSWYFPLLKNYSESDFGGPLASQADYQDPWLKQRLEHNGWVLWAPIRFGATSINFSTDKPFPSPPSRQNWLGTDANGGDVLARILYGTRISVLFGLMLTLCSSVMGVLAGALQGYYGGKVDLWGQRFIEVWSGMPTLFLIILLSSVVQPNFWWLLAITVLFGWMSLVGVVRAEFLRTRNFDYIRAAQALGVSDRSIILRHMLPNAMVATLTFLPFILCSSITTLTSLDFLGFGLPLGSPSLGELLLQGKNNLQAPWLGITAFLSVAILLSLLIFIGEAVRDAFDPNKAV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.55 | 0.00011 | ●●○○○ -1.45 | -1.4456177215016432 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.13 | 0.00043 | ●●○○○ -1.36 | -1.3581950415313706 | 29101196 |
Retrieved 2 of 2 entries in 2.3 ms
(Link to these results)