Bacterial taxon 1392858
Locus CO715_18130
Protein ATI07466.1
ABC transporter substrate-binding protein
Escherichia coli M12
Length 347 aa, Gene n/a, UniProt n/a
>ATI07466.1|Escherichia coli M12|ABC transporter substrate-binding protein
MHYRQLLPFLLSGFLLLSPSIFAAEKILRYTDHEPYGGMRTQIIKEIFFAEIEKESQGRLKIEPHWNGETAISYDALTTISDGSKADMGIVVPEYTAKQLPLHQIFKSFAIGPDHGASQVEFFRRVYAEIPEFNAELERNNIVNLQFFLGYPVGFFSTRPIDKLTALQGTTWRTASFWHRAYLTHTGAKTVTLPWNDQITKALMDGKLDGLMVNLDSGYDIHAERAAPNVLLSPSLWLGHVYLLVMNKQSWENLDNRDREAIQRAAITTEKALGKALDNNLISMVKTLEQEGAQVRYLKKSGLDAWQKAIGYQQEQAQWVEKQNKEGVEKAGEVMQKVANILDETMR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.8 | 5.3e-10 | ●○○○○ -0.66 | -0.6642383981396579 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.58 | 2.7e-7 | ●○○○○ -0.41 | -0.40969026075604725 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)