Bacterial taxon 1392858
Locus CO715_22115
Protein ATI08187.1
acetolactate synthase isozyme 2 small subunit
Escherichia coli M12
Length 87 aa, Gene n/a, UniProt n/a
>ATI08187.1|Escherichia coli M12|acetolactate synthase isozyme 2 small subunit
MMQHQVNVSARFNPETLERVLRVVRHRGFHVCSMNMAAASDAQNINIELTVASPRSVDLLFSQLNKLVDVAHVAICQSTTTSQQIRA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.23 | 3.6e-7 | ○○○○○ 0.08 | 0.0806278727287768 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.73 | 0.00013 | ○○○○○ 0.91 | 0.9074920271970139 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)