Bacterial taxon 1392858
Locus CO715_02925
Protein ATI04781.1
acetyltransferase YpeA
Escherichia coli M12
Length 141 aa, Gene n/a, UniProt n/a
>ATI04781.1|Escherichia coli M12|acetyltransferase YpeA
MEIRVFRQEDFEEVITLWERCDLLRPWNDPEMDIERKMNHDVSLFLVAEVNGEVVGTVMGGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPEDNDMVLGMYERLGYEHADVLSLGKRLIEDEEY
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.44 | 1.5e-19 | ●●○○○ -1.42 | -1.4226666599342686 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.35 | 1.6e-14 | ●○○○○ -0.78 | -0.7796196440192782 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)