Bacterial taxon 1392858
Locus CO715_09685
Protein ATI05954.1
adenosylcobalamin/alpha-ribazole phosphatase
Escherichia coli M12
Length 203 aa, Gene n/a, UniProt n/a
>ATI05954.1|Escherichia coli M12|adenosylcobalamin/alpha-ribazole phosphatase
MRLWLIRHGETQANIDGLYSGHAPTPLTARGIEQAQNLHTLLHGVSFDLVLCSELERAQHTARRVLSDRQLPVQIIPELNEMFFGDWEMRHHRDLMQEDAENYSAWCNDWQHAIPTNGEGFQAFSQRVERFIARLSEFQHYQNILVVSHQGVLSLLIARLIGMPAEAMWHFRVDQGCWSAIDINQKFATLRVLNSRAIGVENA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.48 | 2.2e-15 | ●●○○○ -1.01 | -1.0149723480919937 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.65 | 0.00024 | ●○○○○ -0.01 | -0.007212099269993833 | 29101196 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)