Bacterial taxon 1392858
Locus CO715_04415
Protein ATI05050.1
adenosylcobinamide-GDP ribazoletransferase
Escherichia coli M12
Length 247 aa, Gene n/a, UniProt n/a
>ATI05050.1|Escherichia coli M12|adenosylcobinamide-GDP ribazoletransferase
MSKLFWAMLSFITRLPVLRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCGVPLAALFSVLVLALMTGGFHLDGLADTSDGVFSARSRDRMLEIMRDSRLGTHGGLALIFVVLAKILVLSELALRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQTCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGELVFLLALL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.16 | 3.6e-8 | ●○○○○ -0.95 | -0.948414269546607 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.67 | 2.7e-8 | ●○○○○ -0.85 | -0.8451344924934207 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)