Bacterial taxon 1392858   Locus CO715_18245   Protein ATI07487.1

agmatinase

Escherichia coli M12

Length 306 aa, Gene n/a, UniProt n/a

>ATI07487.1|Escherichia coli M12|agmatinase
MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIRQVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRMLSFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNHSVQIGIRTEFDKDNGFTVLDACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQAAKKGE

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus BALB/c)mammary gland BTO:000081724 hnot available in this study-11.174.6e-16●●○○○ -1.78-1.783415618570549429101196
Mouse (Mus musculus BALB/c)spleen BTO:000128124 hnot available in this study-8.91.4e-13●●○○○ -1.31-1.311458334339625629101196
Retrieved 2 of 2 entries in 1.7 ms (Link to these results)