Bacterial taxon 1392858
Locus CO715_05660
Protein ATI05257.1
AlpA family phage regulatory protein
Escherichia coli M12
Length 75 aa, Gene n/a, UniProt n/a
>ATI05257.1|Escherichia coli M12|AlpA family phage regulatory protein
MKKMAIVDKKGLEYIPNIDRMIREKECRELTTLANSTRWKLEKEGKFPKRIKIGATAVAYRLSEVQAWIRGEWRT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.04 | 5.7e-15 | ●●○○○ -1.13 | -1.1311881780286093 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.76 | 2.3e-11 | ●○○○○ -0.66 | -0.6561012035839522 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)