Bacterial taxon 1392858
Locus CO715_08760
Protein ATI05796.1
amino acid ABC transporter substrate-binding protein
Escherichia coli M12
Length 248 aa, Gene n/a, UniProt n/a
>ATI05796.1|Escherichia coli M12|amino acid ABC transporter substrate-binding protein
MKSVLKVSLAALTLAFAVSSHAADKKLVVATDTAFVPFEFKQGDKYVGFDVDLWAAIAKELKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANNNDVKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDTPNILYFIKTAGNGQFKAVGDSLEAQQYGIAFPKGSDELRDKVNGALKTLRENGTYNEIYKKWFGTEPK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.83 | 6.8e-23 | ●○○○○ -0.67 | -0.6692459024816306 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.54 | 4.1e-31 | ○○○○○ 1.49 | 1.4927440971650698 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)