Bacterial taxon 1392858
Locus CO715_14305
Protein ATI06775.1
anaerobilin reductase
Escherichia coli M12
Length 207 aa, Gene n/a, UniProt n/a
>ATI06775.1|Escherichia coli M12|anaerobilin reductase
MTPWLLFGAGGKGVGARTLELALAEQRPVVAVIRHADAATKLAQQGVQVFTGDACDASVVAAACRAAGPDALIISTMGGAQDYLAHRTVIDEAEKAGISRMILVTSLGCGDSWPFLSERAKAAFGQAVREKTLAESWLQTSQLDYAILRPGGLLDGAATGKAQRIQNQECHGFVHRADVAAHIHELANAPALNQQVHSLIEPDLKPA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.23 | 3.1e-18 | ●○○○○ -0.96 | -0.9623935525012808 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.33 | 5.5e-19 | ○○○○○ 1.24 | 1.23986512789545 | 29101196 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)