Bacterial taxon 1392858
Locus CO715_20845
Protein ATI07956.1
anti-sigma-28 factor FlgM
Escherichia coli M12
Length 97 aa, Gene n/a, UniProt n/a
>ATI07956.1|Escherichia coli M12|anti-sigma-28 factor FlgM
MSIDRTSPLKPVSTVQPRETTDAPVTNTRAAKTTASTSTSVTLSDAQAKLMQPGSSDINLERVEALKLAIRNGELKMDTGKIADALINEAQQDLQSN
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.85 | 0.023 | ●●○○○ -1.72 | -1.7185267081391538 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.43 | 0.043 | ●●○○○ -1.63 | -1.630895382154632 | 29101196 |
Retrieved 2 of 2 entries in 18.3 ms
(Link to these results)