Bacterial taxon 1392858
Locus CO715_24950
Protein ATI08658.1
antirestriction protein
Escherichia coli M12
Length 157 aa, Gene n/a, UniProt n/a
>ATI08658.1|Escherichia coli M12|antirestriction protein
MKTLSQNTTSSACAPETDLQKLVATPVPDERRISFWPQHFGLIPQWVTLEPRIFGWMDRLCEDYCGGIWNLYTLNNGGAFMAPEPDDDDDETWVLFNAMNGNRAEMSPEAAGIAACLMTYSHHACRTECYAMTVHYYRLRDYALQHPECSAIMRIID
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.34 | 1.9e-11 | ●○○○○ -0.36 | -0.3583633412508273 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3 | 6.0e-6 | ○○○○○ 1.17 | 1.1712205892075747 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)