Bacterial taxon 1392858
Locus CO715_07815
Protein ATI05625.1
antitermination protein
Escherichia coli M12
Length 127 aa, Gene n/a, UniProt n/a
>ATI05625.1|Escherichia coli M12|antitermination protein
MRDIQMVLERWGAWAANNHEDVTWSSIAAGFKGLIPSKVKSRPQCCDDDAMIICGCMARLKKNNSDLHDLLVDYYVCGMTFMSLASKHCCSDGYIGKRLQKAEGIIEGMLMALDIRLDMDIVANNSN
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -12.88 | 7.1e-11 | ●●●○○ -2.14 | -2.1402003029361025 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.62 | 8.0e-9 | ●●○○○ -1.46 | -1.4610575265560588 | 29101196 |
Retrieved 2 of 2 entries in 1.7 ms
(Link to these results)