Bacterial taxon 1392858
Locus CO715_05120
Protein ATI05165.1
antitoxin of toxin-antitoxin stability system
Escherichia coli M12
Length 69 aa, Gene n/a, UniProt n/a
>ATI05165.1|Escherichia coli M12|antitoxin of toxin-antitoxin stability system
MNHADAYHLDQAFPLLMKQLELMLTSGELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.51 | 2.1e-16 | ●●○○○ -1.02 | -1.0216490205479574 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.99 | 6.9e-9 | ●○○○○ -0.5 | -0.4950264805838315 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)