Bacterial taxon 1392858
Locus CO715_11880
Protein ATI06344.1
AraC family transcriptional regulator
Escherichia coli M12
Length 318 aa, Gene n/a, UniProt n/a
>ATI06344.1|Escherichia coli M12|AraC family transcriptional regulator
MLQNCAQSNCRIIPKKLRDMKREEICRLLADKVNKLKNKENSLSELLPDVRLLYGETPFARTPVMYEPGIIILFSGHKIGYINERVFRYDANEYLLLTVPLPFECETYATSEVPLAGLRLNVDILQLQELLMDIGEDEHFQPSMAASGINSATLSEEILCAAERLLDVMERPLDARILGKQIIREILYYVLTGPCGGALLALVSRQTHFSLISRVLKRIENKYTENLSVEQLAAEANMSVSAFHHNFKSVTSTSPLQYLKNYRLHKARMMIIHDGMKASAAAMRVGYESASQFSREFKRYFGVTPGEDAARMRAMQGN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.37 | 1.1e-16 | ●○○○○ -0.99 | -0.9909780564533747 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.67 | 3.2e-14 | ○○○○○ 1.31 | 1.3116393567970583 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)