Bacterial taxon 1392858
Locus CO715_08440
Protein ATI05737.1
arginine ABC transporter substrate-binding protein
Escherichia coli M12
Length 243 aa, Gene n/a, UniProt n/a
>ATI05737.1|Escherichia coli M12|arginine ABC transporter substrate-binding protein
MKKVLIAALIAGFSLSATAAETIRFATEASYPPFESIDANNQIVGFDVDLAQALCKEIDATCTFSNQAFDSLIPSLKFRRVEAVMAGMDITPEREKQVLFTTPYYDNSALFVGQQGKYTSVDQLKGKKVGVQNGTTHQKFIMDKHPEITTVPYDSYQNAKLDLQNGRIDSVFGDTAVVTEWLKDNPKLAAVGDKVTDKDYFGTGLGIAVRQGNTELQQKLNTALEKVKKDGTYETIYNKWFQK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.32 | 3.4e-5 | ●●○○○ -1.19 | -1.1894004160040417 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 6.92 | 5.9e-8 | ○○○○○ 1.99 | 1.9905734871628527 | 29101196 |
Retrieved 2 of 2 entries in 2 ms
(Link to these results)