Bacterial taxon 1392858
Locus CO715_13210
Protein ATI06581.1
arginine repressor
Escherichia coli M12
Length 156 aa, Gene n/a, UniProt n/a
>ATI06581.1|Escherichia coli M12|arginine repressor
MRSSAKQEELVKAFKALLKEEKFSSQGEIVAALQEQGFDNINQSKVSRMLTKFGAVRTRNAKMEMVYCLPAELGVPTTSSPLKNLVLDIDYNDAVVVIHTSPGAAQLIARLLDSLGKAEGILGTIAGDDTIFTTPANGFTVKDLYEAILELFDQEL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -12.38 | 4.9e-7 | ●●●○○ -2.04 | -2.0358772958116718 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -11.96 | 2.8e-6 | ●●○○○ -1.95 | -1.948454615841399 | 29101196 |
Retrieved 2 of 2 entries in 2.1 ms
(Link to these results)