Bacterial taxon 1392858
Locus CO715_08450
Protein ATI05739.1
arginine transporter permease subunit ArtM
Escherichia coli M12
Length 222 aa, Gene n/a, UniProt n/a
>ATI05739.1|Escherichia coli M12|arginine transporter permease subunit ArtM
MFEYLPELMKGLHTSLTLTVASLIVALILALIFTIILTLKTPVLVWLVRGYITLFTGTPLLVQIFLIYYGPGQFPTLQEYPALWHLLSEPWLCALIALSLNSAAYTTQLFYGAIRAIPEGQWQSCSALGMSKKDTLAILLPYAFKRSLSSYSNEVVLVFKSTSLAYTITLMEVMGYSQLLYGRTYDVMVFGAAGIIYLIVNGLLTLMMRLIERKALAFERRN
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.92 | 1.3e-58 | ●○○○○ -0.27 | -0.27219253736604765 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.28 | 0.033 | ○○○○○ 0.07 | 0.06956963397358717 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)