Bacterial taxon 1392858
Locus CO715_02775
Protein ATI04756.1
arsenate reductase
Escherichia coli M12
Length 118 aa, Gene n/a, UniProt n/a
>ATI04756.1|Escherichia coli M12|arsenate reductase
MVTLYGIKNCDTIKKARRWLEANNIDYRFHDYRVDGLDSELLNGFINELGWEALLNTRGTTWRKLDETTRNKIIDAASAAALMTEMPAIIKRPLLCTPGKPMLLGFSDSSYQQFFHEV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.02 | 0.0046 | ○○○○○ 0.13 | 0.1252781197780331 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.75 | 2.1e-8 | ○○○○○ 1.33 | 1.3281223919227183 | 29101196 |
Retrieved 2 of 2 entries in 2.3 ms
(Link to these results)