Bacterial taxon 1392858
Locus CO715_14390
Protein ATI06791.1
arsenical resistance operon transcriptional repressor ArsD
Escherichia coli M12
Length 120 aa, Gene n/a, UniProt n/a
>ATI06791.1|Escherichia coli M12|arsenical resistance operon transcriptional repressor ArsD
MKTLTVFDPAMCCSTGVCGSDVDQVLVDFSADVQWLKSRGVQVERYNLAQQPMSFVQNEKAKAFLEASGAEGLPLILLGGETVMAGRYPKRAELARWFGIPLEKVGLAPTHCCGGKTDCC
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.41 | 0.00034 | ●●○○○ -1.63 | -1.6254705857841616 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.62 | 0.0045 | ●●○○○ -1.25 | -1.2528288043356954 | 29101196 |
Retrieved 2 of 2 entries in 14.1 ms
(Link to these results)