Bacterial taxon 1392858
Locus CO715_17985
Protein ATI07442.1
ASCH domain-containing protein
Escherichia coli M12
Length 103 aa, Gene n/a, UniProt n/a
>ATI07442.1|Escherichia coli M12|ASCH domain-containing protein
MQPNDITFFQRFQDDILAGRKTITIRDESESHFKTGDVLRVGRFEDDGYFCTIEVTATSTVTLDTLTEKHAEQENMTLTELKKVIADIYPGQTQFYVIEFKCL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.31 | 0.0062 | ●●○○○ -1.81 | -1.8128347065796389 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.53 | 0.031 | ●●○○○ -1.44 | -1.4426966773021592 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)