Bacterial taxon 1392858
Locus CO715_12000
Protein ATI06366.1
ATP-binding protein
Escherichia coli M12
Length 230 aa, Gene n/a, UniProt n/a
>ATI06366.1|Escherichia coli M12|ATP-binding protein
MQSITPPLIAVIGSDGSGKSTVCEHLITVVEKYGAAERVHLGKQAGNVGRAVTKLPLMGKSLHKTIERNQVKTAKKLPGPVPALVITAFVARRLLRFRHMLACRRRGLIVLTDRYPQDQIPGAYDGTVFPPNVEGGRFVSWLASQERKAFHWMASHKPDLVIKLNVDLEVACARKPDHKRESLARKIAITPQLTFGGAQLVDIDANQPLEQVLVDAEKAITDFMTARGYH
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.19 | 2.0e-19 | ○○○○○ 0.09 | 0.08876506728448234 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.54 | 1.0e-10 | ○○○○○ 0.23 | 0.22584549864598424 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)