Bacterial taxon 1392858
Locus CO715_08930
Protein ATI05828.1
ATP-dependent dethiobiotin synthetase BioD
Escherichia coli M12
Length 225 aa, Gene n/a, UniProt n/a
>ATI05828.1|Escherichia coli M12|ATP-dependent dethiobiotin synthetase BioD
MSKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQHNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRGLEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQAIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.72 | 7.3e-8 | ●○○○○ -0.85 | -0.854940855163117 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.46 | 9.5e-6 | ●○○○○ -0.59 | -0.592046877209552 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)