Bacterial taxon 1392858
Locus CO715_11160
Protein ATI06211.1
ATP-independent periplasmic protein-refolding chaperone
Escherichia coli M12
Length 161 aa, Gene n/a, UniProt n/a
>ATI06211.1|Escherichia coli M12|ATP-independent periplasmic protein-refolding chaperone
MRKLTALFVASTLALGAANLAHAADTTTAAPADAKPMMHHKGKFGPHQDMMFKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKAKAEAQIAKMEEQRKANMLAHMETQNKIYNILTPEQKKQFNANFEKRLTERPAAKGKMPATAE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.91 | 1.4e-17 | ●○○○○ -0.69 | -0.6867721676785349 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.46 | 0.00011 | ○○○○○ 1.06 | 1.059594971584434 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)