Bacterial taxon 1392858
Locus CO715_11645
Protein ATI06300.1
bifunctional dihydroneopterin aldolase/7,8-dihydroneopterin epimerase
Escherichia coli M12
Length 122 aa, Gene n/a, UniProt n/a
>ATI06300.1|Escherichia coli M12|bifunctional dihydroneopterin aldolase/7,8-dihydroneopterin epimerase
MDIVFIEQLSVITTIGVYDWEQTIEQKLVFDIEMAWDNRKAAKSDDVADCLSYADIAETVVSHVEGARFALVERVAEEVAELLLARFNSPWVRIKLSKPGAVARAANVGVIIERGNNLKENN
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.92 | 1.0e-8 | ●●○○○ -1.73 | -1.7327146371080766 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.9 | 7.7e-9 | ●●○○○ -1.31 | -1.310832396296879 | 29101196 |
Retrieved 2 of 2 entries in 12.4 ms
(Link to these results)