Bacterial taxon 1392858
Locus CO715_05005
Protein ATI05147.1
bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE
Escherichia coli M12
Length 203 aa, Gene n/a, UniProt n/a
>ATI05147.1|Escherichia coli M12|bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE
MLTEQLRRELDWEKTDGLMPVIVQHAVSGEVLMLGYMNPEALDKTIESGKVTFFSRTKQRLWTKGETSGNFLNVVNIAPDCDNDTLLVLANPIGPTCHKGTSSCFGDTAHQWLFLYQLEQLLAERKSADPETSYTAKLYASGTKRIAQKVGEEGVETALAATVNDRFELTNEASDLMYHLLVLLQDQDLDLTTVIENLRKRHQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -21.56 | 6.6e-6 | ●●●●○ -3.95 | -3.9527082287159603 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -20.96 | 2.6e-5 | ●●●●○ -3.83 | -3.827520620166643 | 29101196 |
Retrieved 2 of 2 entries in 112.6 ms
(Link to these results)