Bacterial taxon 1392858
Locus CO715_01275
Protein ATI04483.1
biofilm peroxide resistance protein BsmA
Escherichia coli M12
Length 109 aa, Gene n/a, UniProt n/a
>ATI04483.1|Escherichia coli M12|biofilm peroxide resistance protein BsmA
MVSRKRNSVIYRFASLLLVLMLSACSALQGTPQSAPPVTDHPQEIRRDQTQGLQRIGSVSTMVRGSPDDALAEIRAKAVAAKADYYVVVMVDETIVTGQWYSQAILYRK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.78 | 3.9e-13 | ●●○○○ -1.29 | -1.2866294586440112 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.58 | 0.00011 | ○○○○○ 1.09 | 1.085049785322795 | 29101196 |
Retrieved 2 of 2 entries in 2 ms
(Link to these results)