Bacterial taxon 1392858
Locus CO715_16480
Protein ATI07170.1
bis(5'-nucleosyl)-tetraphosphatase (symmetrical)
Escherichia coli M12
Length 280 aa, Gene n/a, UniProt n/a
>ATI07170.1|Escherichia coli M12|bis(5'-nucleosyl)-tetraphosphatase (symmetrical)
MATYLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSLGDSVRLVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWLRRQPLLQIDEEKKLVMAHAGITPQWDLKTAKECARDVEAVLSSDSYPFFLDAMYGDMPNNWSPELRGLGRLRFITNAFTRMRFCFPNGQLDMYSKESPEEAPAPLKPWFAIPGPVAEEYSIAFGHWASLEGKGTPEGIYALDTGCCWGGTLTCLRWEDKHYFVQPSNRHKDLGEAAAS
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.28 | 3.1e-6 | ●●○○○ -1.6 | -1.599598480017303 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.74 | 0.022 | ●○○○○ -0.23 | -0.23380167074425712 | 29101196 |
Retrieved 2 of 2 entries in 87.6 ms
(Link to these results)