Bacterial taxon 1392858
Locus CO715_22860
Protein ATI08316.1
C4-dicarboxylate ABC transporter
Escherichia coli M12
Length 323 aa, Gene n/a, UniProt n/a
>ATI08316.1|Escherichia coli M12|C4-dicarboxylate ABC transporter
MSKIIAMLITVSTLFLPSIIQAKPISIKVAYENNPGEPLDVVMRYWADLLNKKSNGEITLALYPSSQLGSKQDVTEQAMMGMNVITLSDVAFLADYEPDLGILFGPYLTDDPQKLFKIYESDWFKQKNESLKKKGIHVVMNNYLYGTRQIISKKPIRTVDDLAGLKIRVPNNVMQIKAIQAMGATPTPMPLGEVYPALTQGVIDGVENPISVLQGQKLYEQARYLTMVNYLTNTSVWIGGEAFFSTLSPEQLEMIHQTGYEAGVYSQKLTLERDAEMLKTMQAAGVEVIYPDTGPFQKKAREVYSQFPEWTPGLYETIQQQLQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.37 | 2.3e-7 | ○○○○○ 0.26 | 0.25943750694005085 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.05 | 0.00016 | ○○○○○ 0.76 | 0.764569507436544 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)