Bacterial taxon 1392858
Locus CO715_05650
Protein ATI08737.1
capsid protein
Escherichia coli M12
Length 89 aa, Gene n/a, UniProt n/a
>ATI08737.1|Escherichia coli M12|capsid protein
MYTTAQLLAANEQKFKFDPLFLRLFFRESYPFTTEKVYLSQIPGLVNMALYVSPIVSGEVIRSRGGSTSEFTPGYVKPKHLAWLSEAFV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.83 | 2.1e-5 | ●○○○○ -0.04 | -0.04330785973504684 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.1 | 0.00099 | ○○○○○ 0.11 | 0.10816914660962643 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)