Bacterial taxon 1392858
Locus CO715_11925
Protein ATI06353.1
carboxymethylenebutenolidase
Escherichia coli M12
Length 47 aa, Gene n/a, UniProt n/a
>ATI06353.1|Escherichia coli M12|carboxymethylenebutenolidase
MPRLTAKDFPQELLDYYDYYAHGKISKREFLNLAAKCSRRDDGISVV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.37 | 1.0e-6 | ●○○○○ -0.37 | -0.36629188979228405 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.2 | 0.045 | ●○○○○ -0.12 | -0.1209241770356232 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)