Bacterial taxon 1392858
Locus CO715_15880
Protein ATI07058.1
carboxymethylenebutenolidase
Escherichia coli M12
Length 271 aa, Gene n/a, UniProt n/a
>ATI07058.1|Escherichia coli M12|carboxymethylenebutenolidase
MATTQQSGFAPAASPLASTIVQTPDDAIVAGFTSIPSQGDNMPAYHARPKQSDGPLPVVIVVQEIFGVHEHIRDICRRLALEGYLAIAPELYFREGDPNDFADIPTLLSGLVAKVPDSQVLADLDHVASWASRNGGDVHRLMITGFCWGGRITWLYAAHNPQLKAAVAWYGKLTGDKSLNSPKQPVDIATDLNAPVLGLYGGQDNSIPQESVETMRQALRAANAKAEIIVYPDAGHAFNADYRPSYHAESAKDGWQRMLEWFKRYGGKKSL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.42 | 0.00017 | ●●○○○ -1 | -1.002453587237062 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.69 | 0.01 | ○○○○○ 1.31 | 1.31497769302504 | 29101196 |
Retrieved 2 of 2 entries in 0.3 ms
(Link to these results)