Bacterial taxon 1392858
Locus CO715_06480
Protein ATI05392.1
cation transport regulator ChaB
Escherichia coli M12
Length 76 aa, Gene n/a, UniProt n/a
>ATI05392.1|Escherichia coli M12|cation transport regulator ChaB
MPYKTKSDLPESVKHVLPSHAQDIYKEAFNSAWDQYKDKEDRRDDASREETAHKVAWAAVKHEYAKGDDDKWHKKS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -12.24 | 1.5e-9 | ●●●○○ -2.01 | -2.0079187299023245 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.4 | 0.00036 | ●○○○○ -0.58 | -0.579945408383118 | 29101196 |
Retrieved 2 of 2 entries in 1.7 ms
(Link to these results)