Bacterial taxon 1392858
Locus CO715_22450
Protein ATI08247.1
cellulose biosynthesis protein BcsQ
Escherichia coli M12
Length 250 aa, Gene n/a, UniProt n/a
>ATI08247.1|Escherichia coli M12|cellulose biosynthesis protein BcsQ
MAVLGLQGVRGGVGTTTITAALAWSLQMLGENVLVVDACPDNLLRLSFNVDFTHRQGWARAMLDGQDWRDAGLRYTSQLDLLPFGQLSIEEQENPQHWQTRLSDICSGLQQLKASGRYHWILIDLPRDSSQITHQLLSLCDHSLAIVNVDANCHIRLHQQALPDGAHILINDFRIGSQVQDDIYQLWLQSQRRLLPMLIHRDEAMAECLAAKQPVGEYRSDALAAEEILTLANWCLLNYSGLKTPVGSKS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.15 | 1.2e-6 | ○○○○○ 0.31 | 0.3070087981887913 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -0.96 | 9.7e-5 | ○○○○○ 0.35 | 0.3456083108248306 | 29101196 |
Retrieved 2 of 2 entries in 2.1 ms
(Link to these results)