Bacterial taxon 1392858
Locus CO715_02060
Protein ATI04622.1
chorismate--pyruvate lyase
Escherichia coli M12
Length 165 aa, Gene n/a, UniProt n/a
>ATI04622.1|Escherichia coli M12|chorismate--pyruvate lyase
MSHPALTQLRALRYFKEIPALDTQLLDWLLLEDSMTKRFEQQGKTVSVTMIREGFVEQNEIPEELPLLPKESRYWLREILLCADGEPWLAGRTVVPVSTLSGPELALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAGLWGRRSRLRLSGKPLLLTELFLPASPLY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.02 | 0.036 | ●○○○○ -0.92 | -0.9179519514662733 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.99 | 3.0e-15 | ●○○○○ -0.5 | -0.4952351265980802 | 29101196 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)