Bacterial taxon 1392858
Locus CO715_04835
Protein ATI05116.1
CoA transferase subunit B
Escherichia coli M12
Length 216 aa, Gene n/a, UniProt n/a
>ATI05116.1|Escherichia coli M12|CoA transferase subunit B
MDAKQRIARRVAQELRDGDIVNLGIGLPTMVANYLPEGIHITLQSENGFLGLGPVTTAHPDLVNAGGQPCGVLPGAAMFDSAMSFALIRGGHIDACVLGGLQVDEEANLANWVVPGKMVPGMGGAMDLVTGSRKVIIAMEHCAKDGSAKILRRCTMPLTAQHAVHMLVTELAVFRFIDGKMWLTEIADGCDLATVCAKTEARFEVAADLNTQRGDL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -12.09 | 2.2e-12 | ●●○○○ -1.98 | -1.9766218277649952 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.27 | 1.9e-9 | ●●○○○ -1.6 | -1.5960514977750722 | 29101196 |
Retrieved 2 of 2 entries in 2.3 ms
(Link to these results)