Bacterial taxon 1392858
Locus CO715_21995
Protein ATI08167.1
colanic acid biosynthesis glycosyltransferase WcaE
Escherichia coli M12
Length 248 aa, Gene n/a, UniProt n/a
>ATI08167.1|Escherichia coli M12|colanic acid biosynthesis glycosyltransferase WcaE
MLLSIITVAFRNLEGIVKTHASLAHLAQADDISFEWIVVDGGSNDGTREYLENLNGIYNLRFVSEPDNGIYDAMNKGIAMAQGKFALFLNSGDIFHQDAANFIRKLKVQKDNVMITGDALLDFGDGHKIKRSAKPGWYIYHSLPASHQAIFFPVSGLKKWRYDLEYKVSSDYALAAKMYRAGYAFKKLNGLVSEFSMGGVSTTNNMELCADAKKVQRQILHVPGFWAELSWHLRQRTTSKTKALYNKS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.54 | 5.2e-99 | ●●○○○ -1.23 | -1.2348852471102933 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.13 | 2.6e-6 | ○○○○○ 0.78 | 0.7812611885764529 | 29101196 |
Retrieved 2 of 2 entries in 2 ms
(Link to these results)