Bacterial taxon 1392858
Locus CO715_05390
Protein ATI05211.1
copper homeostasis protein CutC
Escherichia coli M12
Length 248 aa, Gene n/a, UniProt n/a
>ATI05211.1|Escherichia coli M12|copper homeostasis protein CutC
MALLEICCYSMECALTAQQNGADRVELCAAPKEGGLTPSLGVLKSVRQRVTIPVHPIIRPRGGDFCYSDGEFAAILEDVRTVRELGFPGLVTGVLDVDGNVDMPRMEKIMAAAGPLAVTFHRAFDMCANPLNTLNNLAELGVARVLTSGQKSDALQGLSKIMELIAHGDAPIIMAGAGVRAENLHHFLDAGVLEVHSSAGAWQASPMRYRNQGLSMSSDAHADEYSRYVVDGAAVAEMKGIIERHQAK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.33 | 0.0042 | ○○○○○ 0.06 | 0.059345979275392896 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.79 | 0.041 | ○○○○○ 0.17 | 0.17347534906952003 | 29101196 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)