Bacterial taxon 1392858
Locus CO715_23775
Protein ATI08461.1
copper-binding protein
Escherichia coli M12
Length 110 aa, Gene n/a, UniProt n/a
>ATI08461.1|Escherichia coli M12|copper-binding protein
MKKALQVAMFSLFTVIGFNAQANEHHHETMSEAQPQVISATGVVKTIDLESKKITIHHDPITAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.66 | 4.4e-9 | ○○○○○ 0.2 | 0.19913880882212998 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.22 | 0.00047 | ○○○○○ 0.29 | 0.29240357719137094 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)