Bacterial taxon 1392858
Locus CO715_20700
Protein ATI07929.1
curli assembly protein CsgC
Escherichia coli M12
Length 110 aa, Gene n/a, UniProt n/a
>ATI07929.1|Escherichia coli M12|curli assembly protein CsgC
MNALLLLAALSSQITFNTTQQGDMYTIIPEVTLTQSCLCRVQILSLREGSSGQSQTKQEKTLSLPANQPIALTKLSLNISPDDRVKIVVTVSDGQSLHLSQQWPPSSEKS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.79 | 3.5e-20 | ●○○○○ -0.45 | -0.45246269367706365 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.55 | 0.0017 | ○○○○○ 0.22 | 0.22313310046074902 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)