Bacterial taxon 1392858
Locus CO715_09170
Protein ATI05866.1
cyd operon protein YbgE
Escherichia coli M12
Length 97 aa, Gene n/a, UniProt n/a
>ATI05866.1|Escherichia coli M12|cyd operon protein YbgE
MSKIIATLYAVMDKRPLRALSFVMALLLAGCMFWDPSRFAAKTSELEIWHGLLLMWAVCAGVIHGVGFRPQKVLWQGIFCPLLADIVLIVGLIFFFF
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -15.48 | 6.6e-6 | ●●●○○ -2.68 | -2.6833058780258883 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 8.68 | 0.0035 | ○○○○○ 2.36 | 2.3573731802123508 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)