Bacterial taxon 1392858
Locus CO715_17440
Protein ATI07345.1
cysteine desulfurase sulfur acceptor subunit CsdE
Escherichia coli M12
Length 147 aa, Gene n/a, UniProt n/a
>ATI07345.1|Escherichia coli M12|cysteine desulfurase sulfur acceptor subunit CsdE
MTNPQFAGHPFGTTVTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVAENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAVAKQV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.18 | 9.0e-14 | ●●○○○ -1.16 | -1.1597726819807035 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.85 | 1.0e-11 | ●○○○○ -0.88 | -0.8828994210724646 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)