Bacterial taxon 1392858
Locus CO715_21250
Protein ATI08030.1
cytochrome c-type biogenesis protein CcmE
Escherichia coli M12
Length 159 aa, Gene n/a, UniProt n/a
>ATI08030.1|Escherichia coli M12|cytochrome c-type biogenesis protein CcmE
MNIRRKNRLWIACAVLAGLALTIGLVLYALRSNIDLFYTPGEILYGKRETQQMPEVGQRLRVGGMVMPGSVQRDPNSLKVTFTIYDAEGSVDVSYEGILPDLFREGQGVVVQGELEKGNHILAKEVLAKHDENYTPPEVEKAMEANHRRPASVYKDPAS
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.01 | 0.00068 | ●○○○○ -0.92 | -0.9156568453095357 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.04 | 0.0025 | ○○○○○ 1.39 | 1.3892556740976347 | 29101196 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)