Bacterial taxon 1392858
Locus CO715_18585
Protein ATI07546.1
cytoplasmic protein
Escherichia coli M12
Length 280 aa, Gene n/a, UniProt n/a
>ATI07546.1|Escherichia coli M12|cytoplasmic protein
MKQLHHSGLPLYLDDDGVMVLKPPLNYLGFGRKSAGQMAVVLPEFTEAQRDEPAYDVYRGLSFAEDQERLAADQYQYDITIIMSGTIGRERKKTSGHYHGYNDTRRNTHPELYEVIKGTAAYILQKSPDFAVAPKDLLVDDLIVAVVKEGESIIVPPNYGHCSINIGDGPLVFSNLAYKPCAVHYDTVQFYHGMACYIVEENGQLCVRKNHYYPHIPRIKFATVKGNPHLGITFDTPLYQRYRAAPERFHFLGHVDNYVREIMGMLQYEDDLFPLCQEDA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.9 | 2.0e-8 | ●○○○○ -0.27 | -0.2682282630953192 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.45 | 0.03 | ○○○○○ 0.24 | 0.24399770188563516 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)