Bacterial taxon 1392858
Locus CO715_13935
Protein ATI06708.1
D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
Escherichia coli M12
Length 190 aa, Gene n/a, UniProt n/a
>ATI06708.1|Escherichia coli M12|D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
MAKSVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFRQVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAAAANVGTKVLVRTGKPVTPEAENAADWVLNSLADLPQAIKKQQKPA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.11 | 0.02 | ●●○○○ -1.77 | -1.772774671843858 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.7 | 0.038 | ●●○○○ -1.69 | -1.6853519918735849 | 29101196 |
Retrieved 2 of 2 entries in 18.1 ms
(Link to these results)